Mascot Search Results

Peptide View

MS/MS Fragmentation of RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
Found in ENSP00000288986, gene:NCK1 -- Cytoplasmic protein NCK1 (NCK adaptor protein 1) (SH2/SH3 adaptor protein NCK-alpha)

Match to Query 34548: 3831.743904 from(958.943252,4+)
Title: Elution from: 777.777 to 777.777 period: 100308_b2dw_b1fc_5min_ptyr100_ip1.raw experiment: 1 cycles: 1 precIntensity: 107605.0 FinneganScanNumber: 8794
Data file 100308_DWB2_b1Fc_5min_conj.msm

Click mouse within plot area to zoom in by factor of two about that point
Or,    to   Da      

Monoisotopic mass of neutral peptide Mr(calc): 3831.7341
Fixed modifications: Carbamidomethyl (C)
Variable modifications: 
R1     : Arginine-13C615N4 (R_10)
K2     : Lysine-13C615N2 (K_8)
S4     : Phospho (ST), with neutral loss 97.9769
R22    : Arginine-13C615N4 (R_10)
Y31    : Phospho (Y)
K33    : Lysine-13C615N2 (K_8)
Ions Score: 94  Expect: 1.9e-06  
Matches (Bold Red): 69/362 fragment ions using 103 most intense peaks
# b b++ b* b*++ b0 b0++ Seq. y y++ y* y*++ y0 y0++ #
1 167.1167 84.0620 150.0901 75.5487     R             33
2 303.2258 152.1166 286.1993 143.6033     K 3568.6552 1784.8312 3551.6286 1776.3179 3550.6446 1775.8259 32
3 400.2786 200.6429 383.2520 192.1297     P 3432.5460 1716.7766 3415.5194 1708.2634 3414.5354 1707.7713 31
4 469.3001 235.1537 452.2735 226.6404 451.2895 226.1484 S 3335.4932 1668.2503 3318.4667 1659.7370 3317.4827 1659.2450 30
5 568.3685 284.6879 551.3419 276.1746 550.3579 275.6826 V 3266.4718 1633.7395 3249.4452 1625.2262 3248.4612 1624.7342 29
6 665.4212 333.2143 648.3947 324.7010 647.4107 324.2090 P 3167.4034 1584.2053 3150.3768 1575.6920 3149.3928 1575.2000 28
7 780.4482 390.7277 763.4216 382.2144 762.4376 381.7224 D 3070.3506 1535.6789 3053.3240 1527.1657 3052.3400 1526.6737 27
8 867.4802 434.2437 850.4536 425.7305 849.4696 425.2385 S 2955.3237 1478.1655 2938.2971 1469.6522 2937.3131 1469.1602 26
9 938.5173 469.7623 921.4908 461.2490 920.5067 460.7570 A 2868.2916 1434.6495 2851.2651 1426.1362 2850.2811 1425.6442 25
10 1025.5493 513.2783 1008.5228 504.7650 1007.5388 504.2730 S 2797.2545 1399.1309 2780.2280 1390.6176 2779.2440 1390.1256 24
11 1122.6021 561.8047 1105.5755 553.2914 1104.5915 552.7994 P 2710.2225 1355.6149 2693.1959 1347.1016 2692.2119 1346.6096 23
12 1193.6392 597.3232 1176.6127 588.8100 1175.6286 588.3180 A 2613.1697 1307.0885 2596.1432 1298.5752 2595.1592 1298.0832 22
13 1308.6661 654.8367 1291.6396 646.3234 1290.6556 645.8314 D 2542.1326 1271.5699 2525.1061 1263.0567 2524.1221 1262.5647 21
14 1423.6931 712.3502 1406.6665 703.8369 1405.6825 703.3449 D 2427.1057 1214.0565 2410.0791 1205.5432 2409.0951 1205.0512 20
15 1510.7251 755.8662 1493.6986 747.3529 1492.7146 746.8609 S 2312.0787 1156.5430 2295.0522 1148.0297 2294.0682 1147.5377 19
16 1657.7935 829.4004 1640.7670 820.8871 1639.7830 820.3951 F 2225.0467 1113.0270 2208.0202 1104.5137 2207.0361 1104.0217 18
17 1756.8619 878.9346 1739.8354 870.4213 1738.8514 869.9293 V 2077.9783 1039.4928 2060.9517 1030.9795 2059.9677 1030.4875 17
18 1871.8889 936.4481 1854.8623 927.9348 1853.8783 927.4428 D 1978.9099 989.9586 1961.8833 981.4453 1960.8993 980.9533 16
19 1968.9416 984.9745 1951.9151 976.4612 1950.9311 975.9692 P 1863.8829 932.4451 1846.8564 923.9318 1845.8724 923.4398 15
20 2025.9631 1013.4852 2008.9365 1004.9719 2007.9525 1004.4799 G 1766.8302 883.9187 1749.8036 875.4055 1748.8196 874.9134 14
21 2155.0057 1078.0065 2137.9791 1069.4932 2136.9951 1069.0012 E 1709.8087 855.4080 1692.7822 846.8947 1691.7982 846.4027 13
22 2321.1151 1161.0612 2304.0885 1152.5479 2303.1045 1152.0559 R 1580.7661 790.8867 1563.7396 782.3734 1562.7556 781.8814 12
23 2434.1991 1217.6032 2417.1726 1209.0899 2416.1886 1208.5979 L 1414.6567 707.8320 1397.6302 699.3187 1396.6462 698.8267 11
24 2597.2625 1299.1349 2580.2359 1290.6216 2579.2519 1290.1296 Y 1301.5727 651.2900 1284.5461 642.7767 1283.5621 642.2847 10
25 2712.2894 1356.6483 2695.2629 1348.1351 2694.2788 1347.6431 D 1138.5094 569.7583 1121.4828 561.2450 1120.4988 560.7530 9
26 2825.3735 1413.1904 2808.3469 1404.6771 2807.3629 1404.1851 L 1023.4824 512.2448 1006.4559 503.7316     8
27 2939.4164 1470.2118 2922.3899 1461.6986 2921.4058 1461.2066 N 910.3984 455.7028 893.3718 447.1895     7
28 3070.4569 1535.7321 3053.4303 1527.2188 3052.4463 1526.7268 M 796.3554 398.6813 779.3289 390.1681     6
29 3167.5096 1584.2585 3150.4831 1575.7452 3149.4991 1575.2532 P 665.3149 333.1611 648.2884 324.6478     5
30 3238.5468 1619.7770 3221.5202 1611.2637 3220.5362 1610.7717 A 568.2622 284.6347 551.2356 276.1215     4
31 3481.5764 1741.2918 3464.5499 1732.7786 3463.5658 1732.2866 Y 497.2251 249.1162 480.1985 240.6029     3
32 3580.6448 1790.8260 3563.6183 1782.3128 3562.6343 1781.8208 V 254.1954 127.6013 237.1689 119.0881     2
33             K 155.1270 78.0671 138.1005 69.5539     1

Error Distribution Error Distribution (ppm)

NCBI BLAST search of RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
(Parameters: blastp, nr protein database, expect=20000, no filter, PAM30)
Other BLAST web gateways

All matches to this query

Score Mr(calc): Delta Sequence
93.53831.73410.0098RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
80.53831.70070.0433RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
80.13831.73410.0098RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
65.23831.73410.0098RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
63.93831.70070.0433RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
60.33831.70070.0433RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
56.03831.73410.0098RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
51.33831.70070.0433RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
51.23831.73410.0098RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK
44.93831.73410.0098RKPSVPDSASPADDSFVDPGERLYDLNMPAYVK

Mascot:  http://www.matrixscience.com/