Mascot Search Results

Peptide View

MS/MS Fragmentation of AIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYR
Found in ENSP00000348100, gene:ADD1 -- adducin 1 (alpha) isoform b [Source:RefSeq_peptide;Acc:NP_054908]

Match to Query 34314: 3925.919012 from(982.487029,4+)
Title: Elution from: 777.777 to 777.777 period: 230208_b2dw_b1fc_5min_ptyr100_ip2.raw experiment: 1 cycles: 1 precIntensity: 104129.0 FinneganScanNumber: 10165
Data file 230208_DWB2_b1Fc_5min_conj.msm

Click mouse within plot area to zoom in by factor of two about that point
Or,    to   Da      

Monoisotopic mass of neutral peptide Mr(calc): 3925.9138
Fixed modifications: Carbamidomethyl (C)
Variable modifications: 
Y7     : Phospho (Y)
Ions Score: 45  Expect: 0.13  
Matches (Bold Red): 29/366 fragment ions using 35 most intense peaks
# b b++ b* b*++ b0 b0++ Seq. y y++ y* y*++ y0 y0++ #
1 72.0444 36.5258         A             33
2 185.1284 93.0679         I 3855.8840 1928.4456 3838.8575 1919.9324 3837.8735 1919.4404 32
3 298.2125 149.6099         I 3742.8000 1871.9036 3725.7734 1863.3903 3724.7894 1862.8983 31
4 427.2551 214.1312     409.2445 205.1259 E 3629.7159 1815.3616 3612.6893 1806.8483 3611.7053 1806.3563 30
5 555.3501 278.1787 538.3235 269.6654 537.3395 269.1734 K 3500.6733 1750.8403 3483.6468 1742.3270 3482.6627 1741.8350 29
6 684.3926 342.7000 667.3661 334.1867 666.3821 333.6947 E 3372.5783 1686.7928 3355.5518 1678.2795 3354.5678 1677.7875 28
7 927.4223 464.2148 910.3958 455.7015 909.4117 455.2095 Y 3243.5358 1622.2715 3226.5092 1613.7582 3225.5252 1613.2662 27
8 1055.4809 528.2441 1038.4543 519.7308 1037.4703 519.2388 Q 3000.5061 1500.7567 2983.4796 1492.2434 2982.4955 1491.7514 26
9 1152.5336 576.7705 1135.5071 568.2572 1134.5231 567.7652 P 2872.4475 1436.7274 2855.4210 1428.2141 2854.4370 1427.7221 25
10 1289.5926 645.2999 1272.5660 636.7866 1271.5820 636.2946 H 2775.3948 1388.2010 2758.3682 1379.6877 2757.3842 1379.1957 24
11 1388.6610 694.8341 1371.6344 686.3208 1370.6504 685.8288 V 2638.3359 1319.6716 2621.3093 1311.1583 2620.3253 1310.6663 23
12 1501.7450 751.3761 1484.7185 742.8629 1483.7345 742.3709 I 2539.2674 1270.1374 2522.2409 1261.6241 2521.2569 1261.1321 22
13 1600.8134 800.9104 1583.7869 792.3971 1582.8029 791.9051 V 2426.1834 1213.5953 2409.1568 1205.0821 2408.1728 1204.5900 21
14 1687.8455 844.4264 1670.8189 835.9131 1669.8349 835.4211 S 2327.1150 1164.0611 2310.0884 1155.5478 2309.1044 1155.0558 20
15 1788.8931 894.9502 1771.8666 886.4369 1770.8826 885.9449 T 2240.0829 1120.5451 2223.0564 1112.0318 2222.0724 1111.5398 19
16 1889.9408 945.4740 1872.9143 936.9608 1871.9303 936.4688 T 2139.0353 1070.0213 2122.0087 1061.5080 2121.0247 1061.0160 18
17 1946.9623 973.9848 1929.9357 965.4715 1928.9517 964.9795 G 2037.9876 1019.4974 2020.9610 1010.9842 2019.9770 1010.4921 17
18 2044.0150 1022.5112 2026.9885 1013.9979 2026.0045 1013.5059 P 1980.9661 990.9867 1963.9396 982.4734 1962.9556 981.9814 16
19 2158.0580 1079.5326 2141.0314 1071.0193 2140.0474 1070.5273 N 1883.9134 942.4603 1866.8868 933.9470 1865.9028 933.4550 15
20 2255.1107 1128.0590 2238.0842 1119.5457 2237.1002 1119.0537 P 1769.8704 885.4389 1752.8439 876.9256 1751.8599 876.4336 14
21 2402.1791 1201.5932 2385.1526 1193.0799 2384.1686 1192.5879 F 1672.8177 836.9125 1655.7911 828.3992 1654.8071 827.9072 13
22 2503.2268 1252.1170 2486.2003 1243.6038 2485.2163 1243.1118 T 1525.7493 763.3783 1508.7227 754.8650 1507.7387 754.3730 12
23 2604.2745 1302.6409 2587.2480 1294.1276 2586.2639 1293.6356 T 1424.7016 712.8544 1407.6750 704.3412 1406.6910 703.8491 11
24 2717.3586 1359.1829 2700.3320 1350.6696 2699.3480 1350.1776 L 1323.6539 662.3306 1306.6274 653.8173 1305.6433 653.3253 10
25 2818.4062 1409.7068 2801.3797 1401.1935 2800.3957 1400.7015 T 1210.5698 605.7886 1193.5433 597.2753 1192.5593 596.7833 9
26 2933.4332 1467.2202 2916.4066 1458.7070 2915.4226 1458.2149 D 1109.5222 555.2647 1092.4956 546.7514 1091.5116 546.2594 8
27 3089.5343 1545.2708 3072.5077 1536.7575 3071.5237 1536.2655 R 994.4952 497.7512 977.4687 489.2380 976.4847 488.7460 7
28 3218.5769 1609.7921 3201.5503 1601.2788 3200.5663 1600.7868 E 838.3941 419.7007 821.3676 411.1874 820.3835 410.6954 6
29 3331.6609 1666.3341 3314.6344 1657.8208 3313.6504 1657.3288 L 709.3515 355.1794 692.3250 346.6661 691.3410 346.1741 5
30 3460.7035 1730.8554 3443.6770 1722.3421 3442.6930 1721.8501 E 596.2675 298.6374 579.2409 290.1241 578.2569 289.6321 4
31 3589.7461 1795.3767 3572.7196 1786.8634 3571.7356 1786.3714 E 467.2249 234.1161 450.1983 225.6028 449.2143 225.1108 3
32 3752.8095 1876.9084 3735.7829 1868.3951 3734.7989 1867.9031 Y 338.1823 169.5948 321.1557 161.0815     2
33             R 175.1190 88.0631 158.0924 79.5498     1

Error Distribution Error Distribution (ppm)

NCBI BLAST search of AIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYR
(Parameters: blastp, nr protein database, expect=20000, no filter, PAM30)
Other BLAST web gateways

All matches to this query

Score Mr(calc): Delta Sequence
45.03925.91380.0052AIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYR
19.83925.84860.0704QKPVLQKYAELLVSQGVVNQPEYEEEISKYDK
19.83925.84860.0704QKPVLQKYAELLVSQGVVNQPEYEEEISKYDK
19.03925.87160.0474RPTVLEPIPMEAASSASSTREGQSWQPGAVATLPQR
18.43925.84860.0704QKPVLQKYAELLVSQGVVNQPEYEEEISKYDK
18.43925.87160.0474RPTVLEPIPMEAASSASSTREGQSWQPGAVATLPQR
14.33925.84860.0704QKPVLQKYAELLVSQGVVNQPEYEEEISKYDK
14.33925.84860.0704QKPVLQKYAELLVSQGVVNQPEYEEEISKYDK
13.73925.9681-0.0491KAFTTISTHLTVVIFYYAPFVYTYLRPRNLR
13.73925.9681-0.0491KAFTTISTHLTVVIFYYAPFVYTYLRPRNLR

Mascot:  http://www.matrixscience.com/