Mascot Search Results

Peptide View

MS/MS Fragmentation of TQTPPVSPAPQPTEERLPSSPVYEDAASFK
Found in ENSP00000317189, gene:CTTN -- Src substrate cortactin (Amplaxin) (Oncogene EMS1). [Source:Uniprot/SWISSPROT;Acc:Q1

Match to Query 8066: 3483.515262 from(1162.179030,3+)
Title: Elution from: 777.777 to 777.777 period: 091207_bidira_10min_2e6_4g10.raw experiment: 1 cycles: 1 precIntensity: 45041.0 FinneganScanNumber: 6963
Data file 091207_BidirA_b1_10min_conj.msm

Click mouse within plot area to zoom in by factor of two about that point
Or,    to   Da      

Monoisotopic mass of neutral peptide Mr(calc): 3483.5044
Fixed modifications: Carbamidomethyl (C)
Variable modifications: 
T3     : Phospho (ST), with neutral loss 97.9769
S7     : Phospho (ST), with neutral loss 97.9769
R16    : Arginine-13C615N4 (R_10)
Y23    : Phospho (Y)
K30    : Lysine-13C615N2 (K_8)
Ions Score: 55  Expect: 0.022  
Matches (Bold Red): 57/342 fragment ions using 111 most intense peaks
# b b++ b* b*++ b0 b0++ Seq. y y++ y* y*++ y0 y0++ #
1 102.0550 51.5311     84.0444 42.5258 T             30
2 230.1135 115.5604 213.0870 107.0471 212.1030 106.5551 Q 3187.5102 1594.2587 3170.4837 1585.7455 3169.4996 1585.2535 29
3 313.1506 157.0790 296.1241 148.5657 295.1401 148.0737 T 3059.4516 1530.2294 3042.4251 1521.7162 3041.4411 1521.2242 28
4 410.2034 205.6053 393.1769 197.0921 392.1928 196.6001 P 2976.4145 1488.7109 2959.3880 1480.1976 2958.4039 1479.7056 27
5 507.2562 254.1317 490.2296 245.6184 489.2456 245.1264 P 2879.3618 1440.1845 2862.3352 1431.6712 2861.3512 1431.1792 26
6 606.3246 303.6659 589.2980 295.1527 588.3140 294.6606 V 2782.3090 1391.6581 2765.2824 1383.1449 2764.2984 1382.6529 25
7 675.3460 338.1767 658.3195 329.6634 657.3355 329.1714 S 2683.2406 1342.1239 2666.2140 1333.6107 2665.2300 1333.1186 24
8 772.3988 386.7030 755.3722 378.1898 754.3882 377.6978 P 2614.2191 1307.6132 2597.1926 1299.0999 2596.2086 1298.6079 23
9 843.4359 422.2216 826.4094 413.7083 825.4253 413.2163 A 2517.1664 1259.0868 2500.1398 1250.5735 2499.1558 1250.0815 22
10 940.4887 470.7480 923.4621 462.2347 922.4781 461.7427 P 2446.1293 1223.5683 2429.1027 1215.0550 2428.1187 1214.5630 21
11 1068.5472 534.7773 1051.5207 526.2640 1050.5367 525.7720 Q 2349.0765 1175.0419 2332.0499 1166.5286 2331.0659 1166.0366 20
12 1165.6000 583.3036 1148.5735 574.7904 1147.5894 574.2984 P 2221.0179 1111.0126 2203.9914 1102.4993 2203.0074 1102.0073 19
13 1266.6477 633.8275 1249.6211 625.3142 1248.6371 624.8222 T 2123.9652 1062.4862 2106.9386 1053.9729 2105.9546 1053.4809 18
14 1395.6903 698.3488 1378.6637 689.8355 1377.6797 689.3435 E 2022.9175 1011.9624 2005.8909 1003.4491 2004.9069 1002.9571 17
15 1524.7329 762.8701 1507.7063 754.3568 1506.7223 753.8648 E 1893.8749 947.4411 1876.8483 938.9278 1875.8643 938.4358 16
16 1690.8423 845.9248 1673.8157 837.4115 1672.8317 836.9195 R 1764.8323 882.9198 1747.8057 874.4065 1746.8217 873.9145 15
17 1803.9263 902.4668 1786.8998 893.9535 1785.9158 893.4615 L 1598.7229 799.8651 1581.6964 791.3518 1580.7123 790.8598 14
18 1900.9791 950.9932 1883.9525 942.4799 1882.9685 941.9879 P 1485.6388 743.3231 1468.6123 734.8098 1467.6283 734.3178 13
19 1988.0111 994.5092 1970.9846 985.9959 1970.0005 985.5039 S 1388.5861 694.7967 1371.5595 686.2834 1370.5755 685.7914 12
20 2075.0431 1038.0252 2058.0166 1029.5119 2057.0326 1029.0199 S 1301.5541 651.2807 1284.5275 642.7674 1283.5435 642.2754 11
21 2172.0959 1086.5516 2155.0693 1078.0383 2154.0853 1077.5463 P 1214.5220 607.7646 1197.4955 599.2514 1196.5115 598.7594 10
22 2271.1643 1136.0858 2254.1378 1127.5725 2253.1537 1127.0805 V 1117.4693 559.2383 1100.4427 550.7250 1099.4587 550.2330 9
23 2514.1940 1257.6006 2497.1674 1249.0873 2496.1834 1248.5953 Y 1018.4009 509.7041 1001.3743 501.1908 1000.3903 500.6988 8
24 2643.2366 1322.1219 2626.2100 1313.6086 2625.2260 1313.1166 E 775.3712 388.1892 758.3446 379.6760 757.3606 379.1840 7
25 2758.2635 1379.6354 2741.2369 1371.1221 2740.2529 1370.6301 D 646.3286 323.6679 629.3021 315.1547 628.3180 314.6627 6
26 2829.3006 1415.1539 2812.2741 1406.6407 2811.2900 1406.1487 A 531.3017 266.1545 514.2751 257.6412 513.2911 257.1492 5
27 2900.3377 1450.6725 2883.3112 1442.1592 2882.3271 1441.6672 A 460.2646 230.6359 443.2380 222.1226 442.2540 221.6306 4
28 2987.3697 1494.1885 2970.3432 1485.6752 2969.3592 1485.1832 S 389.2274 195.1174 372.2009 186.6041 371.2169 186.1121 3
29 3134.4382 1567.7227 3117.4116 1559.2094 3116.4276 1558.7174 F 302.1954 151.6013 285.1689 143.0881     2
30             K 155.1270 78.0671 138.1005 69.5539     1

Error Distribution Error Distribution (ppm)

NCBI BLAST search of TQTPPVSPAPQPTEERLPSSPVYEDAASFK
(Parameters: blastp, nr protein database, expect=20000, no filter, PAM30)
Other BLAST web gateways

All matches to this query

Score Mr(calc): Delta Sequence
54.93483.50440.0109TQTPPVSPAPQPTEERLPSSPVYEDAASFK
34.43483.50440.0109TQTPPVSPAPQPTEERLPSSPVYEDAASFK
25.63483.50440.0109TQTPPVSPAPQPTEERLPSSPVYEDAASFK
11.43483.51270.0025QSQMLEMQVELSSMKDRATELQEQLSSEK
10.43483.45220.0630NKGYLPGQGPFVAAFSSSNLGDVSPNILGPR
8.73483.45220.0630NKGYLPGQGPFVAAFSSSNLGDVSPNILGPR
8.33483.50530.0100NDIYSVSRQIEIRGLESAVIYGSLPPGTK
8.03483.51160.0036LRSPAVLAPAVLTPHSGSETPRGTHPGTGHR
7.63483.5230-0.0077NPVTSTYSKMSLQLYQVDSRTYLLDFR
7.53483.5326-0.0173ECGKTFSLHGYLNQHQKIHTGMKPYECK

Mascot:  http://www.matrixscience.com/