Mascot Search Results

Peptide View

MS/MS Fragmentation of TQTPPVSPAPQPTEERLPSSPVYEDAASFK
Found in ENSP00000317189, gene:CTTN -- Src substrate cortactin (Amplaxin) (Oncogene EMS1). [Source:Uniprot/SWISSPROT;Acc:Q1

Match to Query 34032: 3466.498413 from(1156.506747,3+)
Title: Elution from: 777.777 to 777.777 period: 100308_b2dw_b1fc_5min_4g10_ip1.raw experiment: 1 cycles: 1 precIntensity: 34912.0 FinneganScanNumber: 9231
Data file 100308_DWB2_b1Fc_5min_conj.msm

Click mouse within plot area to zoom in by factor of two about that point
Or,    to   Da      

Monoisotopic mass of neutral peptide Mr(calc): 3466.4659
Fixed modifications: Carbamidomethyl (C)
Variable modifications: 
T3     : Phospho (ST), with neutral loss 97.9769
S7     : Phospho (ST), with neutral loss 97.9769
Q11    : Deamidation (NQ)
Y23    : Phospho (Y)
Ions Score: 48  Expect: 0.062  
Matches (Bold Red): 55/342 fragment ions using 107 most intense peaks
# b b++ b* b*++ b0 b0++ Seq. y y++ y* y*++ y0 y0++ #
1 102.0550 51.5311     84.0444 42.5258 T             30
2 230.1135 115.5604 213.0870 107.0471 212.1030 106.5551 Q 3170.4717 1585.7395 3153.4452 1577.2262 3152.4612 1576.7342 29
3 313.1506 157.0790 296.1241 148.5657 295.1401 148.0737 T 3042.4131 1521.7102 3025.3866 1513.1969 3024.4026 1512.7049 28
4 410.2034 205.6053 393.1769 197.0921 392.1928 196.6001 P 2959.3760 1480.1917 2942.3495 1471.6784 2941.3655 1471.1864 27
5 507.2562 254.1317 490.2296 245.6184 489.2456 245.1264 P 2862.3233 1431.6653 2845.2967 1423.1520 2844.3127 1422.6600 26
6 606.3246 303.6659 589.2980 295.1527 588.3140 294.6606 V 2765.2705 1383.1389 2748.2440 1374.6256 2747.2599 1374.1336 25
7 675.3460 338.1767 658.3195 329.6634 657.3355 329.1714 S 2666.2021 1333.6047 2649.1756 1325.0914 2648.1915 1324.5994 24
8 772.3988 386.7030 755.3722 378.1898 754.3882 377.6978 P 2597.1806 1299.0940 2580.1541 1290.5807 2579.1701 1290.0887 23
9 843.4359 422.2216 826.4094 413.7083 825.4253 413.2163 A 2500.1279 1250.5676 2483.1013 1242.0543 2482.1173 1241.5623 22
10 940.4887 470.7480 923.4621 462.2347 922.4781 461.7427 P 2429.0908 1215.0490 2412.0642 1206.5358 2411.0802 1206.0437 21
11 1069.5313 535.2693 1052.5047 526.7560 1051.5207 526.2640 Q 2332.0380 1166.5226 2315.0115 1158.0094 2314.0274 1157.5174 20
12 1166.5840 583.7956 1149.5575 575.2824 1148.5734 574.7904 P 2202.9954 1102.0014 2185.9689 1093.4881 2184.9849 1092.9961 19
13 1267.6317 634.3195 1250.6051 625.8062 1249.6211 625.3142 T 2105.9427 1053.4750 2088.9161 1044.9617 2087.9321 1044.4697 18
14 1396.6743 698.8408 1379.6477 690.3275 1378.6637 689.8355 E 2004.8950 1002.9511 1987.8684 994.4379 1986.8844 993.9458 17
15 1525.7169 763.3621 1508.6903 754.8488 1507.7063 754.3568 E 1875.8524 938.4298 1858.8258 929.9166 1857.8418 929.4246 16
16 1681.8180 841.4126 1664.7914 832.8994 1663.8074 832.4073 R 1746.8098 873.9085 1729.7833 865.3953 1728.7992 864.9033 15
17 1794.9020 897.9547 1777.8755 889.4414 1776.8915 888.9494 L 1590.7087 795.8580 1573.6821 787.3447 1572.6981 786.8527 14
18 1891.9548 946.4810 1874.9283 937.9678 1873.9442 937.4758 P 1477.6246 739.3160 1460.5981 730.8027 1459.6141 730.3107 13
19 1978.9868 989.9971 1961.9603 981.4838 1960.9763 980.9918 S 1380.5719 690.7896 1363.5453 682.2763 1362.5613 681.7843 12
20 2066.0189 1033.5131 2048.9923 1024.9998 2048.0083 1024.5078 S 1293.5398 647.2736 1276.5133 638.7603 1275.5293 638.2683 11
21 2163.0716 1082.0394 2146.0451 1073.5262 2145.0611 1073.0342 P 1206.5078 603.7575 1189.4813 595.2443 1188.4973 594.7523 10
22 2262.1400 1131.5737 2245.1135 1123.0604 2244.1295 1122.5684 V 1109.4551 555.2312 1092.4285 546.7179 1091.4445 546.2259 9
23 2505.1697 1253.0885 2488.1431 1244.5752 2487.1591 1244.0832 Y 1010.3866 505.6970 993.3601 497.1837 992.3761 496.6917 8
24 2634.2123 1317.6098 2617.1857 1309.0965 2616.2017 1308.6045 E 767.3570 384.1821 750.3304 375.6689 749.3464 375.1769 7
25 2749.2392 1375.1232 2732.2127 1366.6100 2731.2286 1366.1180 D 638.3144 319.6608 621.2879 311.1476 620.3038 310.6556 6
26 2820.2763 1410.6418 2803.2498 1402.1285 2802.2658 1401.6365 A 523.2875 262.1474 506.2609 253.6341 505.2769 253.1421 5
27 2891.3134 1446.1604 2874.2869 1437.6471 2873.3029 1437.1551 A 452.2504 226.6288 435.2238 218.1155 434.2398 217.6235 4
28 2978.3455 1489.6764 2961.3189 1481.1631 2960.3349 1480.6711 S 381.2132 191.1103 364.1867 182.5970 363.2027 182.1050 3
29 3125.4139 1563.2106 3108.3873 1554.6973 3107.4033 1554.2053 F 294.1812 147.5942 277.1547 139.0810     2
30             K 147.1128 74.0600 130.0863 65.5468     1

Error Distribution Error Distribution (ppm)

NCBI BLAST search of TQTPPVSPAPQPTEERLPSSPVYEDAASFK
(Parameters: blastp, nr protein database, expect=20000, no filter, PAM30)
Other BLAST web gateways

All matches to this query

Score Mr(calc): Delta Sequence
48.13466.46590.0325TQTPPVSPAPQPTEERLPSSPVYEDAASFK
47.13466.46590.0325TQTPPVSPAPQPTEERLPSSPVYEDAASFK
26.33466.46590.0325TQTPPVSPAPQPTEERLPSSPVYEDAASFK
25.83466.46590.0325TQTPPVSPAPQPTEERLPSSPVYEDAASFK
21.83466.46590.0325TQTPPVSPAPQPTEERLPSSPVYEDAASFK
17.33466.46590.0325TQTPPVSPAPQPTEERLPSSPVYEDAASFK
11.83466.47800.0204KTIGECSMSLRTLSTQEMDYSLDITPPSK
11.63466.45850.0399INLSLSALGNVIAALAGNRSTHIPYRDSK
11.13466.48500.0135DASPVGIKGFNTLPSTEISMYTLSRDPLK
8.33466.5214-0.0230LTTLNSMHSHFILSDDGTVGKYGNEMKLR

Mascot:  http://www.matrixscience.com/